Identification
Name: NapD protein of periplasmic nitrate reductase
Synonyms: Not Available
Gene Name: napD
Enzyme Class: Not Available
Biological Properties
General Function: Not Available
Specific Function: nitrate reductase activity
Cellular Location: Cytoplasmic
KEGG Pathways:
  • nitrate reduction VII (denitrification) PWY-6748
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Thumb
    nitrite + an oxidized unknown electron acceptor + H2O = nitrate + an reduced unknown electron acceptor
    ReactionCard
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    nitrate reductase activity
    Gene Properties
    Locus tag: PA1175
    Strand: -
    Entrez Gene ID: 879211
    Accession: NP_249866.1
    GI: 15596372
    Sequence start: 1275795
    Sequence End: 1276124
    Sequence Length: 329
    Gene Sequence:
    >PA1175
    ATGCCTGAAGCCCTGCAGATCGCCAGCCTCATCCTGCATTGCCGACCCGAGCGACTGCCGGCGGTGAAGGCCAACCTGGCGCTGCTCGACGGCCTGGAGATCTACCAGGAAAGCCCGCAGGGCAAGCTGATCCTGGTGCTGGAAGCCGAACGCGAAGAACAGATTCTCGACACCCTGGGCCAGTTGCAGAACCTGCCAGGAGTGCTCAACGCCGTGCTGGTCTACCACGAGATCCTGCACGACGACGATAGCAACGACGCGGCGGCCATGACCGACCGCGCGATACCGTGCTCGCCCGAGGAGACAATCGATGAACCTCACCCGTCGTGA
    Protein Properties
    Protein Residues: 109
    Protein Molecular Weight: 12 kDa
    Protein Theoretical pI: 4.04
    Hydropathicity (GRAVY score): -0.131
    Charge at pH 7 (predicted): -13.1
    Protein Sequence:
    >PA1175
    MPEALQIASLILHCRPERLPAVKANLALLDGLEIYQESPQGKLILVLEAEREEQILDTLGQLQNLPGVLNAVLVYHEILHDDDSNDAAAMTDRAIPCSPEETIDEPHPS
    References
    External Links:
    Resource Link
    Genome ID: PA1175
    Entrez Gene ID: 879211
    NCBI Protein ID: 15596372
    General Reference: PaperBLAST - Find papers about PA1175 and its homologs