
probable cold-shock protein (PA1159)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | probable cold-shock protein | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | Not Available | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | regulation of transcription, DNA-templated | ||||||||
Specific Function: | nucleic acid binding, DNA binding | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA1159 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 877579 | ||||||||
Accession: | NP_249850.1 | ||||||||
GI: | 15596356 | ||||||||
Sequence start: | 1257772 | ||||||||
Sequence End: | 1257981 | ||||||||
Sequence Length: | 209 | ||||||||
Gene Sequence: |
>PA1159 ATGGCTGATCGTGAGGTCGGAACCGTCAAGTGGTTCAATGACGCCAAAGGTTATGGATTCATTCAACGCGATAGCGGTCCGGACGTGTTCGTTCACTACCGCGCCATCCGCGGCGAGGGTCACCGCTCCCTGGTGGAAGGCCAGAAAGTGGAATTCTCGGTGATCCAGGGCCAGAAAGGCCTGCAAGCGGAAGACGTCTCCAAGGTCTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 69 | ||||||||
Protein Molecular Weight: | 7.7 kDa | ||||||||
Protein Theoretical pI: | 7.69 | ||||||||
Hydropathicity (GRAVY score): | -0.548 | ||||||||
Charge at pH 7 (predicted): | 0.46 | ||||||||
Protein Sequence: |
>PA1159 MADREVGTVKWFNDAKGYGFIQRDSGPDVFVHYRAIRGEGHRSLVEGQKVEFSVIQGQKGLQAEDVSKV | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA1159 and its homologs |