Identification |
Name: |
Alkyl hydroperoxide reductase subunit C |
Synonyms: |
- Alkyl hydroperoxide reductase protein C22
- Peroxiredoxin
- SCRP-23
- Sulfate starvation-induced protein 8
- SSI8
- Thioredoxin peroxidase
|
Gene Name: |
ahpC |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in peroxiredoxin activity |
Specific Function: |
Directly reduces organic hydroperoxides in its reduced dithiol form |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
2 Thiol-containing reductant | + | ROOH | ↔ | Oxidized thiol-containing reductant | + | | + | ROH |
| 2 Thiol-containing reductant + ROOH ↔ Oxidized thiol-containing reductant + Water + ROH ReactionCard |
|
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
2 R'-SH | + | ROOH | → | R'-S-S-R' | + | | + | ROH |
| | |
2 Thiol-containing reductant | + | ROOH | ↔ | Oxidized thiol-containing reductant | + | | + | ROH |
| 2 Thiol-containing reductant + ROOH ↔ Oxidized thiol-containing reductant + Water + ROH ReactionCard | | an organic hydroperoxide + NADH + H + → an alcohol + NAD + + H 2O ReactionCard |
|
Complex Reactions: |
|
2 R'-SH | + | ROOH | → | R'-S-S-R' | + | | + | ROH |
| |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
antioxidant activity | catalytic activity | oxidoreductase activity | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | peroxiredoxin activity | Process |
---|
cell redox homeostasis | cellular homeostasis | cellular process | metabolic process | oxidation reduction |
|
Gene Properties |
Locus tag: |
PA0139 |
Strand: |
+ |
Entrez Gene ID: |
879431 |
Accession: |
NP_248829.1 |
GI: |
15595337 |
Sequence start: |
158199 |
Sequence End: |
158762 |
Sequence Length: |
563 |
Gene Sequence: |
>PA0139
ATGTCCCTGATCAACACTCAAGTCCAACCGTTCAAGGTCAACGCTTTCCACAACGGCAAGTTCATCGAGGTGACCGAGGAATCCCTGAAGGGCAAGTGGTCGGTCCTGATCTTCATGCCGGCTGCCTTCACCTTCAACTGCCCGACCGAGATCGAAGACGCCGCCAACAACTACGGCGAGTTCCAGAAAGCCGGTGCCGAGGTCTACATCGTGACCACCGACACCCACTTCTCGCACAAGGTCTGGCACGAAACCTCCCCGGCAGTCGGCAAGGCCCAGTTCCCGCTGATCGGCGACCCGACCCACCAGCTGACCAACGCCTTCGGCGTGCACATCCCGGAAGAAGGCCTGGCCCTGCGCGGTACCTTCGTGATCAACCCGGAAGGCGTGATCAAGACCGTCGAGATCCACTCCAACGAGATCGCCCGTGACGTCGGCGAGACCGTGCGCAAGCTGAAGGCCGCCCAGTACACCGCCGCCCACCCGGGCGAAGTCTGCCCGGCCAAGTGGAAGGAAGGCGAGAAGACCCTCGCTCCGTCCCTGGACCTGGTCGGCAAGATCTAA |
Protein Properties |
Protein Residues: |
187 |
Protein Molecular Weight: |
20.5 kDa |
Protein Theoretical pI: |
6.3 |
Hydropathicity (GRAVY score): |
-0.182 |
Charge at pH 7 (predicted): |
-3.14 |
Protein Sequence: |
>PA0139
MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTFNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPGEVCPAKWKEGEKTLAPSLDLVGKI |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA0139 and its homologs
|