hypothetical protein (PA0125)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | hypothetical protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | signal transduction, regulation of transcription, DNA-templated | ||||||||
| Specific Function: | sequence-specific DNA binding transcription factor activity, signal transducer activity | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA0125 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 880838 | ||||||||
| Accession: | NP_248815.1 | ||||||||
| GI: | 15595323 | ||||||||
| Sequence start: | 143845 | ||||||||
| Sequence End: | 144072 | ||||||||
| Sequence Length: | 227 | ||||||||
| Gene Sequence: |
>PA0125 ATGAGCACCGTAGTCTCGTTCCGCGCCGATGACGCCCTGGTCGCGGCCCTCGACGAACTGGCCCGCGCCACCCACCGCGACCGACCCTACCACCTGCGGCAGGCGCTCGCGCAGTACCTGGAAAGGCAGCAGTGGCAGGTCGCTGCCATCGATGAAGGCTTGGCCGATGCCAATGCCGGTCGCCTGCTGGAACACATCGAGATCGAGAAGCGCTGGGGGCTGCAATGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 75 | ||||||||
| Protein Molecular Weight: | 8.6 kDa | ||||||||
| Protein Theoretical pI: | 5.58 | ||||||||
| Hydropathicity (GRAVY score): | -0.397 | ||||||||
| Charge at pH 7 (predicted): | -2.29 | ||||||||
| Protein Sequence: |
>PA0125 MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHIEIEKRWGLQ | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA0125 and its homologs | ||||||||